ttjmemnvpdsmcfvnmdkvmsdfvlefnslsdeakfnek.click
Observed Aug 11, 2026, 06:18 UTC (37d ago). Every field below was attested with an Ed25519 signature at scan time.
ttjmemnvpdsmcfvnmdkvmsdfvlefnslsdeakfnek.click is on the survey sweep, which works its way across the whole catalog rather than returning to one name on a schedule. Putting ttjmemnvpdsmcfvnmdkvmsdfvlefnslsdeakfnek.click under watch moves it to the fast lane, where DomainDrift re-checks it about every 5 minutes and signs each reading, so a change becomes a dated event within minutes instead of waiting for the sweep to come round.
Watch ttjmemnvpdsmcfvnmdkvmsdfvlefnslsdeakfnek.click Watching a domain needs a DRM3 account. The reading above stays free and public either way.Steady. No change on record for ttjmemnvpdsmcfvnmdkvmsdfvlefnslsdeakfnek.click in the last day; this reading matches the one before it. The steady record is signed like every other reading. Watch it to catch the next move the moment it lands.
DNS records 3
TLS certificates 0
None.
Subdomains 0
None observed.
Signed at scan time. Check the math yourself. Every line above is part of one signed observation. Re-hash it and check the Ed25519 signature in your own browser; the only network request the check makes is for the published public keys.
Verify this receiptEd25519 receiptthe raw cryptographic proof
- Receipt ID
rcpt_6b80d4fb571a7822- Output Hash
2e2ea880c77aeefa1f75cfca2664a7abbc3621b441b67592b4cd2940edc871f5- Signature
ed25519:996bec99cef52947377107286ea4648485d7068492238df0a985c11356825315e8717c8afb2d20f8967076e7ce478f8ff7fb430ccc52ad38750fc118f38fb104- Public Key
ed25519:4859bb613d650e12dd7478cc307c73a8712fabc115a9dc59f65534ed3c09a8f9- Parent
(genesis)- Plane
- fast